PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00024.40
Common NameAMTR_s00024p00085480, LOC18439226
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family ZF-HD
Protein Properties Length: 186aa    MW: 21282 Da    PI: 8.4985
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00024.40genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.99.1e-322983358
                              ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                                              v YkeClkNhAaslG++a+DGCgEfm+s  e+++  +lkCaACgCHRnFHRr ++
  evm_27.model.AmTr_v1.0_scaffold00024.40 29 MVLYKECLKNHAASLGSYATDGCGEFMES-LEQSDRGGLKCAACGCHRNFHRRVPV 83
                                             689*************************9.6778*******************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-173082IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.1E-273081IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.9E-263280IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.6953281IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.0E-25104172IPR009057Homeodomain-like
SuperFamilySSF466898.28E-16111171IPR009057Homeodomain-like
TIGRFAMsTIGR015653.7E-25115171IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MEVALTHKRD DHPNTAIPSS SSTPHNEPMV LYKECLKNHA ASLGSYATDG CGEFMESLEQ  60
SDRGGLKCAA CGCHRNFHRR VPVSPKSIKR EEREICFYVD EGKREQRERG DGVIRKRIRT  120
RFSVEQKERM LWFAEKMGWR IQKDQEKEIQ AFCEEIGVSR QVFKVWMHNH KGAAGNNNNA  180
SDVTQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A5e-201141711673ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006849460.11e-139PREDICTED: zinc-finger homeodomain protein 6
SwissprotQ9M9S06e-42ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLW1PTK91e-139W1PTK9_AMBTC; Uncharacterized protein
STRINGPOPTR_0012s03770.12e-50(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.25e-43homeobox protein 31
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]